DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and fgf10a

DIOPT Version :10

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_878290.1 Gene:fgf10a / 359830 ZFINID:ZDB-GENE-030715-1 Length:201 Species:Danio rerio


Alignment Length:103 Identity:25/103 - (24%)
Similarity:43/103 - (41%) Gaps:18/103 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 GTVSVTD---TSQIQNITIVGFPDYLNNEFKIALYAKETRRYLCFNDNWRLVGMRELRDTCYFNE 104
            ||.|..|   |.:|:::. ||.         :|:...::..||..|....:.|.|:....|...|
Zfish    94 GTKSKDDPYSTLEIKSVD-VGI---------VAIKGIQSNYYLAINKKGVVYGARDFGIDCKLIE 148

  Fly   105 TIVHG-YFVFRSVVDLQRR----VGFTHRGKPVGPKKS 137
            .|... |..:.|...:.::    ||.:..|:|:..||:
Zfish   149 RIEENRYNTYASAEWMNKKKHMFVGLSANGRPMRAKKT 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 beta-trefoil_FGF8-like 25..148 CDD:466993 25/103 (24%)
fgf10aNP_878290.1 beta-trefoil_FGF7-like 69..199 CDD:466992 25/103 (24%)

Return to query results.
Submit another query.