DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and fgf8a

DIOPT Version :9

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_571356.2 Gene:fgf8a / 30538 ZFINID:ZDB-GENE-990415-72 Length:210 Species:Danio rerio


Alignment Length:112 Identity:29/112 - (25%)
Similarity:45/112 - (40%) Gaps:28/112 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 QCAHNKAIHIAAE-GTVSV-----TDTSQIQNITIVGFPDYLNNEF--KIALYAKETRRYLCFND 86
            |...||.|:..|| |.|..     |||                  |  ::.:...||..|:|.|.
Zfish    66 QVLANKKINAMAEDGDVCAKLIVETDT------------------FGSRVRIKGAETGFYICMNR 112

  Fly    87 NWRLVGMRE-LRDTCYFNETIV-HGYFVFRSVVDLQRRVGFTHRGKP 131
            ..:|:|.:. |...|.|.|.:: :.|...::|......:.||.:|:|
Zfish   113 RGKLIGKKNGLGKDCIFTEIVLENNYTALQNVKYEGWYMAFTRKGRP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 FGF 33..137 CDD:294048 28/109 (26%)
fgf8aNP_571356.2 FGF 52..175 CDD:278592 29/112 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109937
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.