DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and Fgf17

DIOPT Version :10

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_063130250.1 Gene:Fgf17 / 29368 RGDID:2607 Length:267 Species:Rattus norvegicus


Alignment Length:134 Identity:26/134 - (19%)
Similarity:56/134 - (41%) Gaps:20/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNQLERLLFFIVVISGALCTVEDYVIMSQCAHNKAIHIAAEG-TVSVTDTSQIQNITIVGFPDY 64
            |::||.|.            .:.:|.:.|:.:..   |:...| .:|.|.....:...::...|.
  Rat    94 MTDQLSRR------------QIREYQLYSRTSGK---HVQVTGRRISATAEDGNKFAKLIVETDT 143

  Fly    65 LNNEFKIALYAKETRRYLCFNDNWRLVGMRELRD-TCYFNETIV-HGYFVFRSVVDLQRRVGFTH 127
            ..:  ::.:...|:.:|:|.|...:|:|....:. .|.|.|.:: :.|..|::.......:.||.
  Rat   144 FGS--RVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTR 206

  Fly   128 RGKP 131
            :|:|
  Rat   207 QGRP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 beta-trefoil_FGF8-like 25..148 CDD:466993 22/110 (20%)
Fgf17XP_063130250.1 None

Return to query results.
Submit another query.