DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and Fgf8

DIOPT Version :9

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:XP_038963238.1 Gene:Fgf8 / 29349 RGDID:70891 Length:297 Species:Rattus norvegicus


Alignment Length:179 Identity:38/179 - (21%)
Similarity:62/179 - (34%) Gaps:48/179 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNQLERLLFFIVVISGALCTVEDYVIMS-------QCAHNKAIHIAAEG------TVSVTDTSQ 52
            :::||.|.|            :..|.:.|       |...||.|:..||.      .:..|||  
  Rat   124 VTDQLSRRL------------IRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDT-- 174

  Fly    53 IQNITIVGFPDYLNNEFKIALYAKETRRYLCFNDNWRLVGMRELR-DTCYFNETIV-HGYFVFRS 115
                    |..      ::.:...||..|:|.|...:|:.....: ..|.|.|.:: :.|...::
  Rat   175 --------FGS------RVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQN 225

  Fly   116 VVDLQRRVGFTHRGKP-VGPKKSVNDACYMFNKIEAEQFFRHHHNNGNS 163
            .......:.||.:|:| .|.|...:.....|.|    :..|.||....|
  Rat   226 AKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMK----RLPRGHHTTEQS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 FGF 33..137 CDD:294048 25/112 (22%)
Fgf8XP_038963238.1 FGF 134..257 CDD:395115 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109937
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.