DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and FGF8

DIOPT Version :9

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_149353.1 Gene:FGF8 / 2253 HGNCID:3686 Length:244 Species:Homo sapiens


Alignment Length:181 Identity:38/181 - (20%)
Similarity:62/181 - (34%) Gaps:52/181 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNQLERLLFFIVVISGALCTVEDYVIMS-------QCAHNKAIHIAAEG------TVSVTDTSQ 52
            :::||.|.|            :..|.:.|       |...||.|:..||.      .:..|||  
Human    71 VTDQLSRRL------------IRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDT-- 121

  Fly    53 IQNITIVGFPDYLNNEF--KIALYAKETRRYLCFNDNWRLVGMRELR-DTCYFNETIV-HGYFVF 113
                            |  ::.:...||..|:|.|...:|:.....: ..|.|.|.:: :.|...
Human   122 ----------------FGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTAL 170

  Fly   114 RSVVDLQRRVGFTHRGKP-VGPKKSVNDACYMFNKIEAEQFFRHHHNNGNS 163
            ::.......:.||.:|:| .|.|...:.....|.|    :..|.||....|
Human   171 QNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMK----RLPRGHHTTEQS 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 FGF 33..137 CDD:294048 25/114 (22%)
FGF8NP_149353.1 FGF 81..204 CDD:395115 28/140 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109937
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.