DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ths and egl-17

DIOPT Version :10

Sequence 1:NP_610701.2 Gene:ths / 36258 FlyBaseID:FBgn0033652 Length:748 Species:Drosophila melanogaster
Sequence 2:NP_508107.1 Gene:egl-17 / 180402 WormBaseID:WBGene00001185 Length:216 Species:Caenorhabditis elegans


Alignment Length:86 Identity:24/86 - (27%)
Similarity:38/86 - (44%) Gaps:11/86 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GFPD--YLNN-------EFKIALYAKETRRYLCFNDNWRLVGMRELRDT-CYFNETI-VHGYFVF 113
            |:||  .|.:       :.|..|...::|::||||...|:.......|. |.|.|.: .:|:...
 Worm    57 GYPDKHCLTDWNVVGEWDGKFRLQHAQSRKFLCFNKRARITLRFNGSDAKCTFIEEVRDNGFSRL 121

  Fly   114 RSVVDLQRRVGFTHRGKPVGP 134
            ||....:..:||..||:...|
 Worm   122 RSSWKPELYLGFNGRGRFQNP 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
thsNP_610701.2 beta-trefoil_FGF8-like 25..148 CDD:466993 24/86 (28%)
egl-17NP_508107.1 beta-trefoil_FGF8-like 34..157 CDD:466993 24/86 (28%)

Return to query results.
Submit another query.