DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir48c and Ir87a

DIOPT Version :9

Sequence 1:NP_610700.1 Gene:Ir48c / 36257 FlyBaseID:FBgn0033651 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:493 Identity:96/493 - (19%)
Similarity:163/493 - (33%) Gaps:150/493 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 ENRNTRNLMGYPLRVLVTNDPPHCFVDKDELP-----------------GSPN------------ 201
            |::..|:|.|.||........|:.|.:.:|.|                 .|||            
  Fly   324 EDKFPRDLSGCPLTASFRPWEPYIFRNSEEQPVDDYYYGLQGDEDDYNDTSPNYGESDDESYADP 388

  Fly   202 -------------------RYKGSIVTMLKIFADQLNATFQ-----ANPFREFRRYSTADCVQMV 242
                               :..|....|::..|::|:.:.:     :|.:..|::....:...:|
  Fly   389 GEDGDGAIPDTETQSGGKLKLSGIEYEMVQTIAERLHVSIEMQGENSNLYHLFQQLIDGEIEMIV 453

  Fly   243 SDDEIDACGSIFIRTYTYATSQPVRLNRVVIMAPFGNPIEKFYYFFRPFDLYVWIGTGIIVVYIA 307
            ...:.|...|.|:     ::|.|...:.:............|:.|...|:.......||.||..:
  Fly   454 GGIDEDPSISQFV-----SSSIPYHQDELTWCVARAKRRHGFFNFVATFNADAGFLIGIFVVTCS 513

  Fly   308 VMGSLLHRWH-FKEWNVGQYL---LLAVQTLLNRELSLP-QSSSGSKFMLLLLLFAIGFILSNLY 367
            ::..|..|.. |:..|:..|.   |..:..|||:  ::| |....:...|..|.|.:||..||.|
  Fly   514 LVVWLAQRVSGFQLRNLNGYFPTCLRVLGILLNQ--AIPAQDFPITLRQLFALSFLMGFFFSNTY 576

  Fly   368 VALLSMMLTTKLYQRPIENLADLKAANVNILLQTHNIRPNSVYGSSEELRERFLLVEESQHLEKR 432
            .:.|...|||......|..|.::.:..:.::            |:||.:|          ||.|.
  Fly   577 QSFLISTLTTPRSSYQIHTLQEIYSNKMTVM------------GTSEHVR----------HLNKD 619

  Fly   433 NGLDPSYAYVDSEDRMDFYL-----------------------YQQKFLRRR-----RMKKLSNP 469
            ..:   :.|:..:.:|.:.|                       |..:..|.|     |.:.|   
  Fly   620 GEI---FKYIREKFQMCYNLVDCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRRESL--- 678

  Fly   470 VGYTWAVQVIKQNWVLEKHY------NDHVQRFFETGLQNKLVDD------VHELAVKAGFLHFF 522
              |.:.|.::     |.|.|      |..:|...|:|...|...|      :||...:   :...
  Fly   679 --YVYLVTML-----LPKKYHLLHQINPVIQHIIESGHMQKWARDLDMRRMIHEEITR---VRED 733

  Fly   523 PTQTQTIEPLRLEDIVMAAMVLGGGHALAVIC-FLVEL 559
            |.:..|.:..|      .|:...||..|...| |..||
  Fly   734 PFKALTFDQFR------GAIAFSGGLLLVASCVFAFEL 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir48cNP_610700.1 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 12/71 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.