DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG14518

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:185 Identity:43/185 - (23%)
Similarity:71/185 - (38%) Gaps:30/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AHQDLIQIQISALRFGPTLRSKFTNISVECSKDYCSSIRGW-------LTAKGELNLDIHLNRTL 72
            ||......|..|:.|      |.||...|...      :.|       |.|.....:.::::..|
  Fly    11 AHSLQPPYQCDAVIF------KMTNAVCETYN------KSWVEFGLCRLRAVSRNKVCLNVDANL 63

  Fly    73 KNGLRTTITLLQLIDGKDRYQT-LFSYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCP-- 133
            .:.:...|...:|:...:.|:. |:|...|.|:.:|....:.:..||  .:|| |..:...||  
  Fly    64 LHPVHDVIVKARLLKRANGYKPWLYSVSFDGCQFIRRRNNALIRIVW--ELFKEYSTINHTCPYV 126

  Fly   134 -IQPASYDVRNFQLENHSIPGYLPAGFYRLHDTNYYGKPKGRQRRPVATFILDIK 187
             :|    .|:||.|.:..:|..:|.|.|.|.....:.|..........||:.|:|
  Fly   127 GLQ----QVKNFYLRSEKLPTPIPTGEYLLMIDWVFNKKPQAATNVYFTFVEDLK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 25/96 (26%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 25/95 (26%)

Return to query results.
Submit another query.