DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG14456

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:159 Identity:28/159 - (17%)
Similarity:58/159 - (36%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LRSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNRTLKN---GLRTTITLLQLIDGKDRYQT 94
            :|.||.:|.....:.:.|....:..:...||..:.:::.|.:   .:...||..|    ...|.|
  Fly    25 MRPKFKDIKFWSDEKFVSHKVVYDNSDPHLNFSMEVHQELHDVDIHVEVRITNKQ----DPYYNT 85

  Fly    95 LFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENHSIPGYLPAGF 159
            ..:..::.|:.|....:|.:.:.....:.::||:.:.|||....|......|:......|....|
  Fly    86 NLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETCPIAKGRYHWHRIHLKRKLQGSYFINKF 150

  Fly   160 YRLHDTNYYGKPKGRQRRPVATFILDIKF 188
            :...|             |....:.:::|
  Fly   151 WWPED-------------PTTAMLPELEF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 16/91 (18%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 17/98 (17%)

Return to query results.
Submit another query.