DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33721

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001036743.1 Gene:CG33721 / 3885576 FlyBaseID:FBgn0053721 Length:181 Species:Drosophila melanogaster


Alignment Length:170 Identity:39/170 - (22%)
Similarity:63/170 - (37%) Gaps:53/170 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FGPTLRS----KFTNISVEC--------SKDYCSSIRGWLTAKGELNLDIHLNRTLK------NG 75
            ||..:.:    :|||.  :|        |.:|| .|:.             :|||.|      |.
  Fly    15 FGNIMENASKLEFTNF--KCHVKDPTYLSFEYC-FIKS-------------VNRTYKYISLKANM 63

  Fly    76 LRTTIT----LLQLIDGKDRYQTL-FSYDMDTCKTL--RELLQSSLMKVWLRNVFKYGNLADRCP 133
            ....||    .||:......|..: .:..:|.||.:  ::.|.:.:::::.....||.|...:||
  Fly    64 YEVPITNASAKLQISRRFRSYMPITIAASIDVCKYMAYKKNLANPMLRLFEEITKKYTNTNHKCP 128

  Fly   134 IQPASYDVRNFQLENHSIPGYLPAGFYRLHDTNYYGKPKG 173
                 ||       :..|...||:.:...|.||....|.|
  Fly   129 -----YD-------HDLIIDRLPSKYLSEHFTNILPLPPG 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 20/86 (23%)
CG33721NP_001036743.1 DUF1091 74..160 CDD:461928 22/95 (23%)

Return to query results.
Submit another query.