DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG13590

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:270 Identity:57/270 - (21%)
Similarity:102/270 - (37%) Gaps:91/270 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly  1424 VESDKVQIVKDGRKHKLVLKDVAKTDSGVYRCVSNADK---TEAEIFVKRPNKFMKKLS------ 1479
            |:.||..:|.:|.||.:...|    :..|...|...:|   ||..:....|::..:.|.      
  Fly    20 VKPDKSGVVTEGVKHSMNPFD----EIAVEEAVKLKEKKIATEVVVVSVGPSQSQEVLRTALAMG 80

  Fly  1480 -------DTVGNETEKL-------VLDIQVQDEEADVAFFLGE---------------------- 1508
                   :..|.|.:.|       :|....|||:||:. .||:                      
  Fly    81 ADRGIHVEVAGKEFDLLQPIHVSKILAKLAQDEKADLV-ILGKQAIDDDCNQTAQMTAAVLDWPQ 144

  Fly  1509 ----TELKKDG-RIDIINNGDGTHQLVFNKLELTDAGEIRCECGPLTSK-CTL-KINKKETKPKF 1566
                ::::|:| .:.::...||..:.:..|:....:.::|..    |.: .|| .|.|.:.||..
  Fly   145 ATFASKVEKEGDTLKVVREVDGGLETIKTKMPAVVSADLRLN----TPRYATLPNIMKAKKKPIK 205

  Fly  1567 EVPPK---IETPAKVEKV-VEVPFTTGESRQSKVVAKLYKDGKPVPPEDVDIVVENDKLVLKFKK 1627
            ::.||   ::|..::|.| :|.|    ..||:         |..:|  |||.::           
  Fly   206 KLAPKDLGVDTTPRIEIVSIEDP----PVRQA---------GSILP--DVDTLL----------- 244

  Fly  1628 TEFKDSGEYK 1637
            |:.:|.|..|
  Fly   245 TKLRDGGHIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778
CG13590NP_611919.1 DM8 83..171 CDD:214778 15/88 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.