DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33923

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027216.2 Gene:CG33923 / 3772652 FlyBaseID:FBgn0053923 Length:178 Species:Drosophila melanogaster


Alignment Length:166 Identity:39/166 - (23%)
Similarity:72/166 - (43%) Gaps:34/166 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HQDLIQIQISALRFGPTLRSKFTNISVECSKDYCSSIRGWLTAKGE----LNLDIHLNRTLKNGL 76
            ||.:.:::.:.::. .||..:|.:.      |||     :|.|...    |:|.:.|..|....:
  Fly    18 HQAVCKVEFANIKC-VTLDPEFADF------DYC-----YLKAVSRTYKYLSLRVKLLETPITKI 70

  Fly    77 RTTITLLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYD 140
            :..:.:||.::|...:  |::..:|.||..:....:.:.: :|.:.|| |.|:...||     ||
  Fly    71 KINVAILQRLNGYKPF--LYNVTIDACKFYKNQKSNPIAR-YLYSFFKDYSNINHSCP-----YD 127

  Fly   141 ----VRNFQLE--NHSIPGYLPA--GFYRLHDTNYY 168
                |....:.  |..:...||.  |.|..| :|:|
  Fly   128 HDIIVEKLPISHVNTQVTKVLPVPHGDYLFH-SNWY 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 22/87 (25%)
CG33923NP_001027216.2 DUF1091 72..157 CDD:461928 22/92 (24%)

Return to query results.
Submit another query.