DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33725

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:151 Identity:31/151 - (20%)
Similarity:57/151 - (37%) Gaps:29/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFTNISVECSKDYCSSIRGW-------LTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQ 93
            ||||.:  |    .|..:.|       |.|.....:.::.|.|:.:.....|..::|....:.::
  Fly    28 KFTNFA--C----LSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLHPANNIIVHVKLFKKANGFK 86

  Fly    94 T-LFSYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDVRNFQLENHSIPGYLP 156
            . |....:|.|:.:|......:..::  ::|| :..:...||...... |::|.|....:....|
  Fly    87 PWLLDVKLDACRFVRTNFHPFVRIIF--DLFKDFSTINHTCPYVGLQV-VKDFYLRPEKLKLPFP 148

  Fly   157 AGFYRL-----------HDTN 166
            :|.|.|           .|||
  Fly   149 SGDYLLSLIWIFDKRPQFDTN 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 18/89 (20%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:461928 15/82 (18%)

Return to query results.
Submit another query.