DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33658

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027209.1 Gene:CG33658 / 3772524 FlyBaseID:FBgn0053658 Length:181 Species:Drosophila melanogaster


Alignment Length:140 Identity:32/140 - (22%)
Similarity:59/140 - (42%) Gaps:39/140 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFTNISVECSKDYCSSIRGWLTAKGELNLDI----HLNRT------------LKNGLRTTITLLQ 84
            :|||..       |:|:     ||...:::.    .:|||            |.|.|:....|.|
  Fly    29 EFTNFK-------CTSM-----AKDVADIEYCFLKSVNRTYQYLSTRIKVLKLLNSLKVNFGLHQ 81

  Fly    85 LIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKV---WLRNVFKYGNLADRCPIQPASYDVRNFQL 146
            .|:|...:  |::..:|.|:.::....:.:.|.   ::||:   .||...||.   ::|:...:|
  Fly    82 QINGYKPF--LYNITIDGCQFMKNTKSNVVAKYFYDFIRNI---SNLNHSCPY---NHDIIMEKL 138

  Fly   147 ENHSIPGYLP 156
            .:.:|...||
  Fly   139 TSETINSRLP 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 15/69 (22%)
CG33658NP_001027209.1 DUF1091 84..160 CDD:461928 16/73 (22%)

Return to query results.
Submit another query.