DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33784

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027169.1 Gene:CG33784 / 3772181 FlyBaseID:FBgn0053784 Length:183 Species:Drosophila melanogaster


Alignment Length:134 Identity:34/134 - (25%)
Similarity:58/134 - (43%) Gaps:11/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFTNISVEC-SKDYCSSIRGWL--TAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQT-LF 96
            ||.|:...| .|.:|...|..|  ..:|.:.|::|. :..|..:::|..:|.|......|:. ||
  Fly    28 KFKNVKCTCYEKSFCELKRCELKVLGRGIVGLNLHA-QVYKLPIKSTTCVLTLFRRFSGYRPFLF 91

  Fly    97 SYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYD--VRNFQLENHSI-PGYLPAG 158
            :..:|.|..|:...:.....:....:..:.||...||.   ::|  |....|.:..| ...:|.|
  Fly    92 NVTVDVCHFLKHRKRYPFADLVYDGIKSFSNLNHTCPF---NHDIIVNQMVLNDDMISKAPVPNG 153

  Fly   159 FYRL 162
            ||:|
  Fly   154 FYKL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/76 (25%)
CG33784NP_001027169.1 DUF1091 76..157 CDD:461928 20/83 (24%)

Return to query results.
Submit another query.