DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33798

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027414.1 Gene:CG33798 / 3772108 FlyBaseID:FBgn0053798 Length:178 Species:Drosophila melanogaster


Alignment Length:118 Identity:27/118 - (22%)
Similarity:55/118 - (46%) Gaps:19/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYG 126
            ::|.:||.:|..|.::....:.:.::|...:  |::..:|.||.::....:.:.| ::..|||..
  Fly    53 ISLKVHLFQTPVNQIKVNTAIYKRLNGYKPF--LYNVTVDGCKFIKNQNSNPVTK-FIFGVFKDA 114

  Fly   127 -NLADRCP------IQPASYDVRNFQLENHSIPGYLPAGFYRL------HDTN 166
             |:...||      ::..|.:..|||: ...:|  .|.|.|.:      :|.|
  Fly   115 TNMNHSCPYDHDIIMEKLSAESINFQI-TKILP--FPEGKYMVKMNWFAYDIN 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 21/89 (24%)
CG33798NP_001027414.1 DUF1091 69..154 CDD:461928 20/90 (22%)

Return to query results.
Submit another query.