DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33688

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027131.1 Gene:CG33688 / 3772065 FlyBaseID:FBgn0053688 Length:175 Species:Drosophila melanogaster


Alignment Length:147 Identity:34/147 - (23%)
Similarity:67/147 - (45%) Gaps:35/147 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FTNISVECSKDYCSSIRG---------WLTAKGELN--LDIHLNRTLKNGLRTTITLLQLIDGKD 90
            |||:  :|      .|||         ::.|....:  :||::|  |...:...:|:::|:...:
  Fly    23 FTNL--KC------GIRGEKIYYFEKCFIKAVNRTHKYIDIYVN--LHQQVVNNVTVIKLMRHNN 77

  Fly    91 RYQTLF-SYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDVRNFQLENHSIPG 153
            .|:..| ...:|.||.|::..||.:.|::  :::| ..|:...||       .::..:.:|...|
  Fly    78 GYKPFFVDVTIDVCKFLKDPRQSIIKKLY--DIYKNNSNINHTCP-------YKDVVIVHHLWTG 133

  Fly   154 YLPAGFYR---LHDTNY 167
            .|.:.|.:   |.|.:|
  Fly   134 NLESDFMKYLPLIDGDY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 20/82 (24%)
CG33688NP_001027131.1 DUF1091 72..152 CDD:461928 21/88 (24%)

Return to query results.
Submit another query.