DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33775

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027410.1 Gene:CG33775 / 3772054 FlyBaseID:FBgn0053775 Length:182 Species:Drosophila melanogaster


Alignment Length:152 Identity:33/152 - (21%)
Similarity:63/152 - (41%) Gaps:21/152 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ISALRFGPTLRSKFTNISVECSKDYCSSIRGW------LTAKGELNLDIHLN--RTLKNGLRTTI 80
            :.:|..|...|||...|:::| :.|..|...:      |..:|.:..|::|.  :|.........
  Fly    17 LCSLSLGSECRSKSRFINMQC-ESYNESYAVFEKCKLNLLGRGRVGADMYLKLFQTPVENCWINW 80

  Fly    81 TLLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYD--VRN 143
            .:.:..:|...:  |::...|.|:.|......|...:.:..:.|..||...||.   ::|  |.|
  Fly    81 AMYRRYNGFQPF--LYNVSTDLCQLLGNPNAISFQGLVINAIKKGSNLNHSCPY---NHDIIVDN 140

  Fly   144 FQLEN---HSIPGYLPAGFYRL 162
            .:..:   .::|  ||.|.|::
  Fly   141 MEFSDDFLKTLP--LPQGVYKI 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 18/77 (23%)
CG33775NP_001027410.1 DUF1091 78..160 CDD:461928 19/88 (22%)

Return to query results.
Submit another query.