DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33767

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027141.1 Gene:CG33767 / 3772047 FlyBaseID:FBgn0053767 Length:188 Species:Drosophila melanogaster


Alignment Length:161 Identity:42/161 - (26%)
Similarity:78/161 - (48%) Gaps:21/161 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FGPTLRSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQ 93
            |.||.   |.|.::|...:             .|.:|:..::.:..||:..:.....:|....||
  Fly    43 FSPTY---FENFTLEIQNN-------------TLFMDMTTSKPIHRGLKVLLNTQISLDKGRSYQ 91

  Fly    94 TLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENHSIPGYLPAG 158
            .||::.:|||..:.. ::.:|.|.|..::.|:||....||:....|.:|:::|::|.:|.|:..|
  Fly    92 RLFAHILDTCGVVSS-VRGNLFKSWFDSMLKHGNFMVNCPVPAGHYFLRDWKLDSHLVPHYMLPG 155

  Fly   159 FYRLHDTNYYGKPKGRQRRPVATFILDIKFY 189
            .|.:....::||.|.:|..    |.||::.|
  Fly   156 DYCITAHFFFGKHKSKQEE----FFLDLEVY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 27/91 (30%)
CG33767NP_001027141.1 DM8 90..180 CDD:214778 30/94 (32%)

Return to query results.
Submit another query.