DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33641

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027256.1 Gene:CG33641 / 3771970 FlyBaseID:FBgn0053641 Length:181 Species:Drosophila melanogaster


Alignment Length:75 Identity:18/75 - (24%)
Similarity:39/75 - (52%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQP-ASYDVRNFQLENHSIPGYLPAG 158
            |:...:|.|..||.:.::.|...::::..|:.|:...||.:. .:|.:.::.|:...:|.:.|.|
  Fly    89 LYDVRVDGCLILRTIHKNKLFYFYVKSFKKHSNVVLSCPFKANFTYKMDDWFLDEEELPPFAPVG 153

  Fly   159 FYRLHDTNYY 168
            .:|. .|.|:
  Fly   154 QFRT-VTEYF 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 18/75 (24%)
CG33641NP_001027256.1 DUF1091 80..156 CDD:461928 15/66 (23%)

Return to query results.
Submit another query.