DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33796

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:156 Identity:41/156 - (26%)
Similarity:66/156 - (42%) Gaps:37/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFTNISVECSKDYCSSI-RGWLTAKGELNLDIHLNRTLKNGLRT------TITLLQLIDGKDRYQ 93
            |.||:       :|.|. :.|:.........|:.:||:.|...|      :||:        .||
  Fly    28 KLTNV-------HCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLYPTKSITV--------HYQ 77

  Fly    94 T----------LFSYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDVRNFQLE 147
            |          |.:..:|.|:.||:...:  :.:.|.|::: :.|:...||:| ....|||..|.
  Fly    78 TFKRENGYRPWLVNTQIDGCRFLRKPYDA--LGILLFNIYRNFTNINHTCPLQ-GDMIVRNMYLT 139

  Fly   148 NHSIPGYLPAGFYRLH-DTNYYGKPK 172
            ...:...||.|.|.|. |..:||||:
  Fly   140 TDVMRLPLPTGDYLLAIDWIFYGKPQ 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 28/94 (30%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:461928 22/90 (24%)

Return to query results.
Submit another query.