DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33752

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027409.1 Gene:CG33752 / 3771860 FlyBaseID:FBgn0053752 Length:185 Species:Drosophila melanogaster


Alignment Length:92 Identity:21/92 - (22%)
Similarity:39/92 - (42%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LRTTITLLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCP--IQPAS 138
            :....|:.:.:.|...:  ||:..:|.|..::.....::...:...|..|.|....||  :..:.
  Fly    70 ISVNFTVYKKLSGYHPF--LFNVTVDFCHYMKHPNPMNIFHYFYTAVKPYSNFNHSCPYNVSESY 132

  Fly   139 YD--VRNFQLEN---HSIPGYLPAGFY 160
            :|  |::|.|.:   ..||  ||.|.|
  Fly   133 HDILVKDFVLTDTMFAKIP--LPTGNY 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/77 (25%)
CG33752NP_001027409.1 DUF1091 72..159 CDD:461928 21/90 (23%)

Return to query results.
Submit another query.