DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33631

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027167.1 Gene:CG33631 / 3771784 FlyBaseID:FBgn0053631 Length:195 Species:Drosophila melanogaster


Alignment Length:138 Identity:34/138 - (24%)
Similarity:63/138 - (45%) Gaps:25/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ISALRFGPTLRSKFTNISVECSKDYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDG 88
            :.||.:....|.||| |.:...::..|:   :||    .|:.|.:..|   |....:||||:   
  Fly    54 MKALSYIDETRLKFT-IFISLREELGSN---FLT----FNIKIRVRPT---GRTNFVTLLQM--- 104

  Fly    89 KDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQLENHSIPG 153
                     .|:|.|....|..::.:||.:|::..:..::. .||::..:|.|:|..::: ..|.
  Fly   105 ---------RDLDLCGFFTEFRKNPMMKYFLQSEMQLSDII-VCPVRVGNYSVKNVSVKD-IYPQ 158

  Fly   154 YLPAGFYR 161
            .|..|.|:
  Fly   159 VLQNGIYK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 16/71 (23%)
CG33631NP_001027167.1 DUF1091 84..167 CDD:461928 24/100 (24%)

Return to query results.
Submit another query.