DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33642

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001027257.1 Gene:CG33642 / 3771733 FlyBaseID:FBgn0053642 Length:187 Species:Drosophila melanogaster


Alignment Length:122 Identity:28/122 - (22%)
Similarity:63/122 - (51%) Gaps:17/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSL 114
            |.:.|.:..|.::. ||.::.|:.....:....::|.||:          :|.|:.|:...::.|
  Fly    59 SYVNGEMIVKSDVE-DILMHTTMDFWKTSNQKKIKLYDGR----------LDACQFLKTSHRNGL 112

  Fly   115 MKVWLRNVFK--YGNLADRCPIQP-ASYDVRNFQLENHSIPGYLPAGFYRLHDTNYY 168
            .|:::::..|  :|||:  ||::. .:|.:.|:.::...:|.::|.|.:|. .|.|:
  Fly   113 FKIYVKSFKKHIHGNLS--CPLRTNFNYTLTNWHMDEKDLPPFVPLGTFRT-VTEYF 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 19/81 (23%)
CG33642NP_001027257.1 DUF1091 79..160 CDD:461928 20/92 (22%)

Return to query results.
Submit another query.