DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG14492

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_611275.2 Gene:CG14492 / 37045 FlyBaseID:FBgn0034283 Length:199 Species:Drosophila melanogaster


Alignment Length:97 Identity:23/97 - (23%)
Similarity:40/97 - (41%) Gaps:28/97 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 LFSYDMDTCKTLRELLQSSLMKVWLRNVF-KYGNLADRCPIQP-ASYDVRNFQLENHSIP----- 152
            |.:...|.|:.|....|..||::. ||:. ::.|...:||.:| .:|.:|.|:|:.:.:|     
  Fly    99 LLNVTTDGCQLLANRNQVPLMRLG-RNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLVPAVDME 162

  Fly   153 --------------------GYLPAGFYRLHD 164
                                |||.|...|:.:
  Fly   163 TPVQIEFSHQNKQQGIRWITGYLMARVQRISE 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 23/97 (24%)
CG14492NP_611275.2 DM8 95..186 CDD:214778 20/87 (23%)

Return to query results.
Submit another query.