DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13193 and CG33483

DIOPT Version :10

Sequence 1:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:152 Identity:36/152 - (23%)
Similarity:67/152 - (44%) Gaps:29/152 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFTNISVECSK--------DYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKDRY 92
            :||||  :|:.        :|| .::....:...|:|.::|::.....::...:||:..:|...:
  Fly    76 EFTNI--KCTSWDKAFDDFEYC-HLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYKPF 137

  Fly    93 QTLFSYDMDTCKTLRELLQSSLMKVWLRNVFK-YGNLADRCPIQPASYDV------RNFQLENHS 150
              |::..:|.||.||....:.:.. :...:|| :.|:...||.   .:|:      .||.  |..
  Fly   138 --LYNITVDACKALRHSKYNPIFS-FFYGLFKHHSNMNHTCPF---DHDLIVEKLPTNFM--NQK 194

  Fly   151 IPGYL--PAGFYRLHDTNY-YG 169
            :.|.:  |.|.|..|...| ||
  Fly   195 VNGDIKFPHGDYLFHSDWYAYG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13193NP_610699.1 DM8 91..183 CDD:214778 23/89 (26%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:461928 22/92 (24%)

Return to query results.
Submit another query.