DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir48b and Ir87a

DIOPT Version :9

Sequence 1:NP_610697.1 Gene:Ir48b / 36254 FlyBaseID:FBgn0033648 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:338 Identity:73/338 - (21%)
Similarity:109/338 - (32%) Gaps:106/338 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 VTHAKPLHSYRYLTAPFQWSVWACLVIYVLLVVNFLSFIGWLRSGKWEFSKYLLEVFSSLLFSGF 350
            |..||..|.:....|.|.......:.|:|:.    .|.:.||                :...|||
  Fly   481 VARAKRRHGFFNFVATFNADAGFLIGIFVVT----CSLVVWL----------------AQRVSGF 525

  Fly   351 YLKEIRGRERYI--------------------------LFGVLFIAGFVYSTEYLGLLKSMLISE 389
            .|:.:.|   |.                          ||.:.|:.||.:|..|...|.|.|.:.
  Fly   526 QLRNLNG---YFPTCLRVLGILLNQAIPAQDFPITLRQLFALSFLMGFFFSNTYQSFLISTLTTP 587

  Fly   390 VFEKQIDTFEALVESNITLM--------------VDPYDKILFAK-YNMPEILSPIM--ELVSFE 437
            ....||.|.:.:..:.:|:|              :..|.:..|.. ||:.:.|:...  |.::..
  Fly   588 RSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNEHIAVA 652

  Fly   438 TLLKH---RNRFDQDYAYILFSDRMALYDYAQQFLKHPKLLRIPIDFSFLYTGIPMRKRWFLKHH 499
            ...:|   ..|..:|..| .|..|.:||.|....|                    :.|::.|.|.
  Fly   653 VSRQHSFYNPRIQRDRLY-CFDRRESLYVYLVTML--------------------LPKKYHLLHQ 696

  Fly   500 LGRAWYWAFESGLTRKLALDADF------EAVRVGYLSFLITEHVEAQPLNVDYFVMPAIALAIG 558
            :........|||..:|.|.|.|.      |..||....|        :.|..|.| ..|||.:.|
  Fly   697 INPVIQHIIESGHMQKWARDLDMRRMIHEEITRVREDPF--------KALTFDQF-RGAIAFSGG 752

  Fly   559 YIL-ALLSFVIEM 570
            .:| |...|..|:
  Fly   753 LLLVASCVFAFEL 765

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir48bNP_610697.1 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.