DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir48b and Ir76a

DIOPT Version :10

Sequence 1:NP_610697.1 Gene:Ir48b / 36254 FlyBaseID:FBgn0033648 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster


Alignment Length:107 Identity:22/107 - (20%)
Similarity:37/107 - (34%) Gaps:34/107 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VGGNWKMNGDKASITELCKTLSAGPLDPNTEVVVGCP---APY-----------------LSLAR 51
            |||.:|..|.....:  |:|..:|       ::.|.|   .||                 ::::.
  Fly   247 VGGAYKNTGVNTQTS--CRTDRSG-------LISGSPWIRVPYPFQWGPPTFHAGEAFAMMAVSF 302

  Fly    52 SLLPETIGVAAQNCYKVAKGAFTGEISPAMLKDLGLGWVILG 93
            ..|.|:.|.     |.|.....:....|..:...|:||..:|
  Fly   303 VSLIESTGT-----YIVVSRFASATPPPPSVLSRGVGWQGVG 339

Return to query results.
Submit another query.