DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir48b and Ir56b

DIOPT Version :9

Sequence 1:NP_610697.1 Gene:Ir48b / 36254 FlyBaseID:FBgn0033648 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:445 Identity:97/445 - (21%)
Similarity:177/445 - (39%) Gaps:77/445 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LIYTSYDEKLYHKIIFPET-VIEETLVEQYISIRGSFNNLYGYPVRVAAYNNAPRSMLYVNRWGK 213
            :|.:.|...:.|..||.|| .:.......|:.|...|..:|.|.:.:.:..:.|:..:.    .:
  Fly    11 VIRSPYSFDIPHAFIFNETQFVVPKFCGPYMEIVKHFAEVYHYQLFLDSLESLPKKSVV----EQ 71

  Fly   214 HIFAGFYMRFLRAFIDARNGSFVPVLTPSNSPGNCTLNLVNETVDVCADALAANPAAFSLT-HGF 277
            .|.:|.|...|...|          :.|            .||.|.           |:.| |.:
  Fly    72 DIISGKYNLSLHGVI----------IRP------------EETSDF-----------FNATQHSY 103

  Fly   278 --RIASANVLVTHAKPLHSYRYLTAPFQWSVWACLVIYVLLVVNFLSFIGWLRSGK--WEFSKYL 338
              .:.:..|:|..|..|..:.|:..|....:|.||.:....|...|.::.|...|.  ..:::.:
  Fly   104 PLELMTNCVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNV 168

  Fly   339 LEVFSSLLFSGFYLKEIRGRE---RYILF-GVLFIAGFVYSTEYLGLLKSMLISEVFEKQIDTFE 399
            |...:.|:||......::.:.   |.|:| .:|:|.||:.:..:|..:.:..:..||.:.|||:.
  Fly   169 LHAMALLMFSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWS 233

  Fly   400 ALVESNITLMVDPYDKILFAKYNMPEILSPIMELVSFETLLKHRNRFDQDYAYILFSDRMALYDY 464
            .|:.|.:.:::  :|          .:|..:..|..::.||...:|   .|||::..|....::.
  Fly   234 DLIHSRLRIVI--HD----------SLLEELRWLPVYQALLASPSR---SYAYVVTQDAWLFFNR 283

  Fly   465 AQQFLKHPKLLRIPIDFSFLYTGIPMRKRWFLKHHLGR-------AWYWAFESGLTRKLALDADF 522
            .|:.|..|......:.|..|:..:||.........|.:       |..|.:...|..:.|..|.:
  Fly   284 QQKVLIQPYFHLSKVCFGGLFNALPMASNASFADSLNKFILNVWQAGLWNYWEELAFRYAEQAGY 348

  Fly   523 EAVRVGYLSFLITEHVEAQPLNVDYFVMPAIALAIGYILALLSFVIEMTAWRIRE 577
            ..|      ||.|..||  |||:::|....|.|:.|..::.|:|.:|:...|.::
  Fly   349 AKV------FLDTYPVE--PLNLEFFTTAWIVLSAGIPISSLAFCLELFIHRRKQ 395



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.