DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir48b and Ir54a

DIOPT Version :9

Sequence 1:NP_610697.1 Gene:Ir48b / 36254 FlyBaseID:FBgn0033648 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_611259.2 Gene:Ir54a / 37022 FlyBaseID:FBgn0034272 Length:586 Species:Drosophila melanogaster


Alignment Length:407 Identity:83/407 - (20%)
Similarity:150/407 - (36%) Gaps:69/407 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NFTQVEYNLGADNKLFLIMGNEEPP--YDFLHALNLHFQFAEYIIVIDEPVDLKKSTKWLDFVNH 140
            |||....:..:..|:..|..|...|  .|::.....|                          ..
  Fly    97 NFTSSLMDFPSQKKIVYISNNFSDPTRMDYIFETCYH--------------------------RR 135

  Fly   141 LWQQGYVQLLIYTSYDEKLYHKIIFPETVIEETLVEQYISIRGSFNNLYGYPVRVAAYNNAPRSM 205
            :|.   :..|:.:......|...::|....|...:|........|.|::|:|:.|......|||:
  Fly   136 IWN---IVGLLASDEHRYFYRYHLYPSFRTEYRSLESSTIFDKDFPNMHGHPLTVMPDQWLPRSV 197

  Fly   206 LYVN-RWGKHIFAGFYMRFLRAFIDARNGSFVPVLTPSNSPG---NCT-LNLVNE--TVDVCA-- 261
            |||: |.||.|.||...||........|.:.  .|:...:.|   |.| |..::|  :|||.|  
  Fly   198 LYVDRRTGKQILAGSVGRFFHVLSWKLNATL--QLSKKVTTGRFLNATALKELSESFSVDVPASL 260

  Fly   262 ------DALAANPAAFSLTHGFRIASANVLVTHAKPLHSYRYLTAPFQWSVWACLVIYVLLVVNF 320
                  :.||:......:||    ....|.|....|:....::.     |..:.:.:.:::|.::
  Fly   261 TIMERVEQLASTSYPMEVTH----VCLMVPVARRIPIKDIYFIL-----SSASNMFLAIVIVSSY 316

  Fly   321 LSFIGWLRS---GKWEFSKYLL--EVFSSLLFSGFYLKEIRGRERYILFGVLFIAGFVYSTEYLG 380
            ...:..||:   .......::|  :....:|...|.|...|.....::|.:|.|.|...|:.:..
  Fly   317 GLALNLLRNMTHRDVRLVDFVLNDKALRGILGQSFNLPLSRSFSTRLIFLMLGIVGLNVSSIFGA 381

  Fly   381 LLKSMLISEVFEKQIDTFEALVESNITLMVDPYDKILFAKYNMPEILSPIMELVSFETLLKHRNR 445
            .|.:::.....:.|..:|..|..:.|.|:....|...:.|..:|.::..:.|   :..|...||.
  Fly   382 GLDTLMAHPPRQFQARSFAGLRRTKIPLVTTEEDFPTWMKLRVPMLVVNVSE---YNHLRNGRNT 443

  Fly   446 FDQDYA----YILFSDR 458
            .:..:|    :.|||::
  Fly   444 SNAYFASRLYWNLFSEQ 460



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.