DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and RNGTT

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_016866890.1 Gene:RNGTT / 8732 HGNCID:10073 Length:603 Species:Homo sapiens


Alignment Length:171 Identity:66/171 - (38%)
Similarity:91/171 - (53%) Gaps:8/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLLQIVPD----MGLIIDLTN 65
            ||.|||.....|..|.| ||:..|..|....:::|.|..|..|..|...:..    |||::||||
Human     6 IPPRWLNCPRRGQPVAG-RFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVKMGLLVDLTN 69

  Fly    66 TNRYYHPSAITNHDVLHQKLMIPGK-QTPSHKLAQRFCAFVTDFLERNADNDKLIGVHCTHGVNR 129
            |:|:|..:.|....:.:.||...|. :.|:.:..:.|......|.|||.  .:|||||||||.||
Human    70 TSRFYDRNDIEKEGIKYIKLQCKGHGECPTTENTETFIRLCERFNERNP--PELIGVHCTHGFNR 132

  Fly   130 TGYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSL 170
            ||:|||.|::..|:.|.|.|:.||:.||...|.:.:||..|
Human   133 TGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKGDYLKEL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 52/133 (39%)
RNGTTXP_016866890.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.