DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and DUSP11

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_003575.3 Gene:DUSP11 / 8446 HGNCID:3066 Length:330 Species:Homo sapiens


Alignment Length:340 Identity:113/340 - (33%)
Similarity:157/340 - (46%) Gaps:56/340 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLLQIV----PDMGLIIDLTN 65
            ||:||..|.|:|.|:||||||||||||.:....|:......:|..|...:    .::|||||||.
Human    31 IPERWKDYLPVGQRMPGTRFIAFKVPLQKSFEKKLAPEECFSPLDLFNKIREQNEELGLIIDLTY 95

  Fly    66 TNRYYHPSAITNHDVLHQKLMIPGKQTPSHKLAQRFCAFVTDFLERNADNDKLIGVHCTHGVNRT 130
            |.|||.|..:. ..|.:.|:...|.|.|..:...:|...|..||:.|.|||||||||||||:|||
Human    96 TQRYYKPEDLP-ETVPYLKIFTVGHQVPDDETIFKFKHAVNGFLKENKDNDKLIGVHCTHGLNRT 159

  Fly   131 GYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSLKTLPNRETVTKLAATERRSSTIDNW 195
            |||||.::|.|..:.|::||:.|:..|||.:||.||:..|:..|.|:                ||
Human   160 GYLICRYLIDVEGVRPDDAIELFNRCRGHCLERQNYIEDLQNGPIRK----------------NW 208

  Fly   196 RQPIDYQSERDLHQKNNHRLSKVLKTKSYQEHDDCRRRDRWNQHPYARNHRPHPVEEQRRIQSNR 260
            ...:...|:   .:.:.|.:..|       .:...::..|:|.|....:..|.....|.:.....
Human   209 NSSVPRSSD---FEDSAHLMQPV-------HNKPVKQGPRYNLHQIQGHSAPRHFHTQTQSLQQS 263

  Fly   261 SRDGYQQGSNQHPYSRNHRPHPVEEQYRIQSNRSGGGYQQGSISYQQEPHQRYQRNWDYSRRNYS 325
            .|   :...|.|.|.|:|.|.|         ...|..|.          |:||  :|:. :.|.|
Human   264 VR---KFSENPHVYQRHHLPPP---------GPPGEDYS----------HRRY--SWNV-KPNAS 303

  Fly   326 ERNYSERNWSERNYS 340
            ......|.|...|||
Human   304 RAAQDRRRWYPYNYS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 58/131 (44%)
DUSP11NP_003575.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5935
eggNOG 1 0.900 - - E1_COG5226
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 173 1.000 Inparanoid score I4091
Isobase 1 0.950 - 0 Normalized mean entropy S5132
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 1 1.000 - - FOG0005200
OrthoInspector 1 1.000 - - oto91295
orthoMCL 1 0.900 - - OOG6_108715
Panther 1 1.100 - - LDO PTHR10367
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3925
SonicParanoid 1 1.000 - - X4820
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.810

Return to query results.
Submit another query.