DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and AT3G09100

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_974263.1 Gene:AT3G09100 / 820064 AraportID:AT3G09100 Length:672 Species:Arabidopsis thaliana


Alignment Length:344 Identity:90/344 - (26%)
Similarity:139/344 - (40%) Gaps:81/344 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLLQIVPD-------MGLIID 62
            ||..||...|.|:.:  ...:..|||||:..|..|....|.   |..|::.:       :||:||
plant    83 IPQGWLDCPPSGNEI--GFLVPSKVPLNESYNNHVPPGSRY---SFKQVIHNQRIAGRKLGLVID 142

  Fly    63 LTNTNRYYHPSAITNHDVLHQKLMIPGKQ-TPSHKLAQRFCAFVTDFLERNADNDKLIGVHCTHG 126
            ||||.|||..:.:....:.|.|:...|:. .|.:.....|...|..|:.....:.|.|.||||||
plant   143 LTNTTRYYSTTDLKKEGIKHVKIACKGRDAVPDNVSVNAFVNEVNQFVLNLKHSKKYILVHCTHG 207

  Fly   127 VNRTGYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSLKTLPNR---ETVTKLAATERR 188
            .||||::|.::::....|:..:|::.||.||...|.:.:|:.:|.:..:.   |:|...:..|.:
plant   208 HNRTGFMIVHYLMRSGPMNVTQALKIFSDARPPGIYKPDYIDALYSFYHEIKPESVICPSTPEWK 272

  Fly   189 SSTIDNWRQPIDYQSERDLHQKNNHRLSKVLKTKSYQEHDDCRRRDRWNQHPYARNHRPHPVEEQ 253
            .||            |.||   |...|..       .|.||              .....||:  
plant   273 RST------------ELDL---NGEALPD-------DEDDD--------------GGPAGPVQ-- 299

  Fly   254 RRIQSNRSRDGYQQGSNQHPYSRNHR-------PHPVEEQYR------IQSNRSGGGYQQ--GS- 302
                      |:|:.|:|.....::.       |...||.||      :..|..|.|..|  || 
plant   300 ----------GFQEESHQVDVKMSNDDVLGDEIPPDQEEGYRQFFYRMLSLNIGGRGCSQFPGSH 354

  Fly   303 -ISYQQEPHQRYQRNWDYS 320
             :|..:|..|..::.:.|:
plant   355 PVSLNRENLQLLRQRYYYA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 42/135 (31%)
AT3G09100NP_974263.1 RNA_5'-triphosphatase 86..252 CDD:350352 53/170 (31%)
mRNA_cap_enzyme 354..547 CDD:396068 4/20 (20%)
mRNA_cap_C 552..645 CDD:397827
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10367
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.