DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and rngtt

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001001222.1 Gene:rngtt / 407900 XenbaseID:XB-GENE-947367 Length:595 Species:Xenopus tropicalis


Alignment Length:171 Identity:64/171 - (37%)
Similarity:88/171 - (51%) Gaps:8/171 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLLQIVPD----MGLIIDLTN 65
            ||.|||.....|..| ..:|:..|..|....:.:|.|..|..|..|...:..    |||::||||
 Frog     6 IPPRWLNCPRRGQPV-AAKFLPLKTMLGPKYDDQVPEENRFHPSMLSNYLKSLKVKMGLLVDLTN 69

  Fly    66 TNRYYHPSAITNHDVLHQKLMIPGK-QTPSHKLAQRFCAFVTDFLERNADNDKLIGVHCTHGVNR 129
            |.|:|..:.|....:.:.||...|. :.||.:....|......|::||.  .:|||||||||.||
 Frog    70 TTRFYDRNDIEKEGIKYIKLQCKGHGECPSQENTDTFLRLCERFIDRNP--TELIGVHCTHGFNR 132

  Fly   130 TGYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSL 170
            ||:|||.|::..|:.|.|.|:.||:.||...|.:.:||..|
 Frog   133 TGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKADYLKEL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 52/133 (39%)
rngttNP_001001222.1 PTPc 47..>143 CDD:328744 39/97 (40%)
Adenylation_mRNA_capping 249..462 CDD:185706
mRNA_cap_C 466..559 CDD:309151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.