DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and rngtt

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_998032.1 Gene:rngtt / 405803 ZFINID:ZDB-GENE-040426-2087 Length:598 Species:Danio rerio


Alignment Length:170 Identity:60/170 - (35%)
Similarity:86/170 - (50%) Gaps:8/170 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLLQIVPD----MGLIIDLTNT 66
            |.||......|..|.| :|:..|..|....:.||.|..|..|..|...:..    |||::|||||
Zfish     7 PPRWRNCPRRGQPVAG-KFLPMKTMLGPRYDDKVPEENRFHPSMLSNYLKSLKVKMGLLVDLTNT 70

  Fly    67 NRYYHPSAITNHDVLHQKLMIPGK-QTPSHKLAQRFCAFVTDFLERNADNDKLIGVHCTHGVNRT 130
            .|:|..:.|....:.:.||...|. :.|:.:..:.|......|:|:..  .:|||||||||.|||
Zfish    71 TRFYDRADIEKEGIKYVKLSCKGHGECPTAETTEMFIRLCEHFIEKTP--TELIGVHCTHGFNRT 133

  Fly   131 GYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSL 170
            |:|||.:::..|:.|.|.|:..|:.||...|.:.:||..|
Zfish   134 GFLICAYLVEKMDWSIEAAVAAFAQARPPGIYKGDYLKEL 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 48/133 (36%)
rngttNP_998032.1 TPase 1..215 60/170 (35%)
PTPc 37..>143 CDD:304379 40/107 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..227
GTase 233..598
Adenylation_mRNA_capping 252..465 CDD:185706
mRNA_cap_C 469..562 CDD:281856
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 575..598
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.