DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and mRNA-cap

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_572952.1 Gene:mRNA-cap / 32379 FlyBaseID:FBgn0030556 Length:649 Species:Drosophila melanogaster


Alignment Length:334 Identity:91/334 - (27%)
Similarity:144/334 - (43%) Gaps:53/334 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLLQ----IVPDMGLIIDLTN 65
            :|:|||......|.:...||:|||.||:.:.:.|:.......||.|.:    :...:||.:||||
  Fly    15 LPNRWLYCPRKSDTIIAERFLAFKTPLSNNFHDKMPIECTFQPEMLFEYCKTLKVKLGLWVDLTN 79

  Fly    66 TNRYYHPSAITNHDVLHQKLMIPGK-QTPSHKLAQRFCAFVTDFL-ERNADNDKLIGVHCTHGVN 128
            |.|:|..||:......:.||...|. :|||.:....|...|.:|: ||..|   :|.||||||.|
  Fly    80 TKRFYDRSAVEELGAKYIKLQCRGHGETPSPEQTHSFIEIVDNFINERPFD---VIAVHCTHGFN 141

  Fly   129 RTGYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSLKTLPNRETVTKLAATERRSSTID 193
            |||:||..:::..::.|...|:..|:.||...|.:.:|::.|.. ...:|....||.|:     .
  Fly   142 RTGFLIVCYLVERLDCSVSAALAIFASARPPGIYKQDYINELYK-RYEDTNAAPAAPEQ-----P 200

  Fly   194 NWRQPIDYQSERDLHQKNNHRLSKVLKTKSYQEHD-----------DC------------RRRDR 235
            ||....|..:.....|.|:   |...:....|:.|           ||            |||:.
  Fly   201 NWCLDYDDGNGDGFVQDNS---SSTSQQAGEQDDDAEEVEGEDAGGDCDASTSDGQPRKKRRREM 262

  Fly   236 WNQH-------PYAR--NHRPHPVEEQRRIQS--NRSRDGYQQGSNQHPYSRNHRPHPVEEQYRI 289
            ..::       |..|  :.:|...:.||::|.  :..::|: .|:......|.:.....|..||:
  Fly   263 IIKNATFMAGVPGVRQVSDQPRLGDLQRKVQDWCDWKKNGF-PGAQPVSMDRENIKRLSEIPYRV 326

  Fly   290 QSNRSGGGY 298
            .....|..|
  Fly   327 SWKADGTRY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 46/133 (35%)
mRNA-capNP_572952.1 PTPc <116..171 CDD:304379 23/57 (40%)
mRNA_cap_enzyme 307..497 CDD:279649 6/29 (21%)
mRNA_cap_C 502..597 CDD:281856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443432
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5226
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10367
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.