DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and clp1

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_594716.1 Gene:clp1 / 2542358 PomBaseID:SPAC1782.09c Length:537 Species:Schizosaccharomyces pombe


Alignment Length:354 Identity:69/354 - (19%)
Similarity:111/354 - (31%) Gaps:96/354 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RFIAFKVPLN---QHVNAKVKENLRLAPESLLQIVPDMGLIIDLTNTNR----------YYHPSA 74
            :||||..|:.   .|.:.:        |:.|.|   ...:::|....|:          .|....
pombe   189 KFIAFASPIQAGWNHASTR--------PKKLPQ---PFAIVLDYFVANKVKLIVRLNGPLYDKKT 242

  Fly    75 ITNHDVLHQKLMIPGKQTPSHKLAQRFCAFVTDFLERNADNDKLIGVHCTHGVNRTGYLICYFMI 139
            ..|..:.|:::.......|...|.:.|..     |....:.|.:|.|||..|:.|||.||..::|
pombe   243 FENVGIRHKEMYFEDGTVPELSLVKEFID-----LTEEVEEDGVIAVHCKAGLGRTGCLIGAYLI 302

  Fly   140 SVMNMSPEEAIQTFSLAR----------------------------GHEIERDNYLSSLKTLPNR 176
            .....:..|.|....:.|                            |..|::......|.|.|..
pombe   303 YKHCFTANEVIAYMRIMRPGMVVGPQQHWLHINQVHFRAYFYEKAMGRAIQQATAAEPLATPPRH 367

  Fly   177 ETVTKLAATERRSSTIDNWRQPIDYQSERDLHQKNNH------RLSKVLKTKSYQEHDDCRRRDR 235
                .|.||...|.:  |...|:...:.....:.:.|      ||......|..::..:..::..
pombe   368 ----PLNATNGTSQS--NISTPLPEPTPGQPRKVSGHNPPSARRLPSASSVKFNEKLKNASKQSI 426

  Fly   236 WNQHPYARNHRPHPVEEQRRIQSN----------------RSRDGYQQGSNQHPYS-RNHRPHPV 283
            .|:     |...:...|...||::                |.|....| ||..|.. |:....|.
pombe   427 QNE-----NKASYSSYEDSEIQNDDETRTVGTPTETISVVRLRRSSSQ-SNIEPNGVRSPTSSPT 485

  Fly   284 EEQYRIQSNRSGGGYQQGSISYQQEPHQR 312
            ....|   ..||..:..|| |:.::..||
pombe   486 GSPIR---RTSGNRWSSGS-SHSKKSAQR 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 29/165 (18%)
clp1NP_594716.1 DSPn 17..155 CDD:291343
CDC14 178..353 CDD:225297 34/179 (19%)
PTPc <255..332 CDD:304379 19/81 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.