DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and ceg1

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_595708.1 Gene:ceg1 / 2540362 PomBaseID:SPBC2F12.08c Length:402 Species:Schizosaccharomyces pombe


Alignment Length:160 Identity:37/160 - (23%)
Similarity:63/160 - (39%) Gaps:48/160 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 MSP-EEAIQTFSLARGHEIERDNYLSSLKTLPNRETVTKLAATERRSSTIDNWRQPIDYQSERDL 207
            |:| |:.|:..|:. |....||: :..|||     .:.||..|   |.......||:.: |::.|
pombe     1 MAPSEKDIEEVSVP-GVLAPRDD-VRVLKT-----RIAKLLGT---SPDTFPGSQPVSF-SKKHL 54

  Fly   208 HQKNNHRLSKVLKTKSY---QEHDDCRRRDRWNQHPYARNHRPHPVEEQRRIQSNRSRDGYQQGS 269
                     :.||.|:|   ::.|..|......:||...| ||                      
pombe    55 ---------QALKEKNYFVCEKSDGIRCLLYMTEHPRYEN-RP---------------------- 87

  Fly   270 NQHPYSRNHRPHPVEE-QYRIQSNRSGGGY 298
            :.:.:.|....:.||: .|.:::::||..|
pombe    88 SVYLFDRKMNFYHVEKIFYPVENDKSGKKY 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 8/27 (30%)
ceg1NP_595708.1 CEG1 1..402 CDD:227551 37/160 (23%)
mRNA_cap_enzyme 45..242 CDD:279649 22/106 (21%)
mRNA_cap_C 247..356 CDD:281856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5226
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10367
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.