DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13197 and cel-1

DIOPT Version :9

Sequence 1:NP_001286319.1 Gene:CG13197 / 36253 FlyBaseID:FBgn0062449 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001020979.1 Gene:cel-1 / 172814 WormBaseID:WBGene00000466 Length:623 Species:Caenorhabditis elegans


Alignment Length:237 Identity:70/237 - (29%)
Similarity:111/237 - (46%) Gaps:35/237 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IPDRWLKYKPIGDRVPGTRFIAFKVPLNQHVNAKVKENLRLAPESLLQIVP------------DM 57
            :|||||.....|..: ...|..||.||     .|:.:| ::| |...|..|            .:
 Worm    15 LPDRWLHCPKTGTLI-NNLFFPFKTPL-----CKMYDN-QIA-ERRYQFHPAEVFSHPHLHGKKI 71

  Fly    58 GLIIDLTNTNRYYHPSAITNHDVLHQKLMIPGK-QTPSHKLAQRFCAFVTDFLERNADNDKLIGV 121
            ||.||||||:|||....:|.|:.::.|:.:.|: .:|:.:....|...|.:|.::..  |:::||
 Worm    72 GLWIDLTNTDRYYFREEVTEHECIYHKMKMAGRGVSPTQEDTDNFIKLVQEFHKKYP--DRVVGV 134

  Fly   122 HCTHGVNRTGYLICYFMISVMNMSPEEAIQTFSLARGHEIERDNYLSSLKTLPNRETVTKLAATE 186
            |||||.||||:||..::..|.....:.||..|:..|...|.:.:|:..|....:.....|:.|.|
 Worm   135 HCTHGFNRTGFLIAAYLFQVEEYGLDAAIGEFAENRQKGIYKQDYIDDLFARYDPTEDDKILAPE 199

  Fly   187 R----------RSSTIDNWRQPIDYQ--SERDLHQKNNHRLS 216
            :          .|:.|||.|.....|  :....:.:|.::||
 Worm   200 KPDWEREMSIGMSTQIDNGRPSTSQQIPATNGNNNQNGNQLS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13197NP_001286319.1 PTPc 43..171 CDD:304379 44/140 (31%)
cel-1NP_001020979.1 PTPc <115..171 CDD:304379 21/57 (37%)
mRNA_cap_enzyme 289..479 CDD:279649
mRNA_cap_C 484..583 CDD:281856
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544021at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.