DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Buffy and BCL2A1

DIOPT Version :10

Sequence 1:NP_523702.1 Gene:Buffy / 36251 FlyBaseID:FBgn0040491 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_004040.1 Gene:BCL2A1 / 597 HGNCID:991 Length:175 Species:Homo sapiens


Alignment Length:108 Identity:29/108 - (26%)
Similarity:48/108 - (44%) Gaps:19/108 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 DAVSLLLGAVGRELFR--VE-------ITWSKVISLFAIAGGLSVDCVRQGHPEYLP------KL 222
            |.|:::.....|.||.  :|       |.|.:::::||..|.|....:||   :..|      ::
Human    57 DNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQ---QIAPDVDTYKEI 118

  Fly   223 MESVSEVIEDELVPWINENGGW-SGINTHVLPTTNSLNPLEWT 264
            ...|:|.|.:....||.:|||| :|......|.:..:..||.|
Human   119 SYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVT 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BuffyNP_523702.1 Bcl-2_like 99..250 CDD:132900 25/92 (27%)
BCL2A1NP_004040.1 Bcl-2_like 10..146 CDD:132900 25/91 (27%)
BH1 77..97 4/19 (21%)
BH2 132..147 7/14 (50%)

Return to query results.
Submit another query.