DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Buffy and Debcl

DIOPT Version :9

Sequence 1:NP_523702.1 Gene:Buffy / 36251 FlyBaseID:FBgn0040491 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_788278.1 Gene:Debcl / 53585 FlyBaseID:FBgn0029131 Length:300 Species:Drosophila melanogaster


Alignment Length:282 Identity:110/282 - (39%)
Similarity:161/282 - (57%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 GTSYPTNNDNFSNGFPMATTQSERLLQAQNRRKFSFPATLHSASLLEVGGGPKETTRRRLSNVSD 67
            |...|.:..|.|||                       .:||:       |||  .||...::...
  Fly    49 GAGGPGSVPNPSNG-----------------------RSLHA-------GGP--MTRAASTSSLA 81

  Fly    68 AVTRKLSYTIGWKAAQIPAQDIISQGRCLCGHYIKRRLRRSGLFNKKLGLQRIRSILGSTSMGIV 132
            :.||.::....:|      .|||:||:||||.||:.||||:|:.|:|: .||:|:||...|..:|
  Fly    82 SSTRTMTNYQEYK------MDIINQGKCLCGQYIRARLRRAGVLNRKV-TQRLRNILDPGSSHVV 139

  Fly   133 RDVFPAVQVLGDELERMHPRIYNGVARQICRNPGGEFHTPDAVSLLLGAVGRELFRVEITWSKVI 197
            .:||||:..:|:||||||||:|..::||:.|.|.||....|...:||..|.::|||..|||.|:|
  Fly   140 YEVFPALNSMGEELERMHPRVYTNISRQLSRAPFGELEDSDMAPMLLNLVAKDLFRSSITWGKII 204

  Fly   198 SLFAIAGGLSVDCVRQGHPEYLPKLMESVSEVIEDELVPWINENGGWSGINTHVLPTTNSLNPLE 262
            |:||:.||.::|||||||.:||..|::.::|:|||:||.|:.:||||.|::.|:.|.......|.
  Fly   205 SIFAVCGGFAIDCVRQGHFDYLQCLIDGLAEIIEDDLVYWLIDNGGWLGLSRHIRPRVGEFTFLG 269

  Fly   263 WTTLVIGVVFGLILVFMILRFI 284
            |.||.:.:..|..:|..:.|.|
  Fly   270 WLTLFVTISAGAYMVSNVCRRI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BuffyNP_523702.1 Bcl-2_like 99..250 CDD:132900 75/150 (50%)
DebclNP_788278.1 Bcl-2_like 107..257 CDD:132900 75/150 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444245
Domainoid 1 1.000 90 1.000 Domainoid score I7754
eggNOG 1 0.900 - - E1_KOG4728
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I4946
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1278637at2759
OrthoFinder 1 1.000 - - FOG0005475
OrthoInspector 1 1.000 - - mtm6365
orthoMCL 1 0.900 - - OOG6_108286
Panther 1 1.100 - - P PTHR11256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3895
1110.800

Return to query results.
Submit another query.