DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment INHBB and scw

DIOPT Version :9

Sequence 1:NP_002184.2 Gene:INHBB / 3625 HGNCID:6067 Length:407 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:414 Identity:93/414 - (22%)
Similarity:158/414 - (38%) Gaps:116/414 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    62 RRP--EELGRVD----GDFLEAVKRHILSRLQMRGRPNITHAVPKAAMVT------------ALR 108
            :||  |::..:|    ||           |.:.:..||:.::..|..:..            .|.
  Fly    33 KRPLSEQMEMIDILDLGD-----------RPRRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLH 86

Human   109 KLHAGKVREDGRVEIPHLDGHASPGADGQERVS--EIISFAETDGLASSRVR---------LYF- 161
            :.|...:.:|..:.          ..|.||..|  .|::|       |||::         ::. 
  Fly    87 QRHKRSLDDDILIS----------NEDRQEIASCNSILTF-------SSRLKPEQLDNELDMHIT 134

Human   162 FISNEGNQNLFVVQASLWLYLKLLPYVLEKGSRRKVRVKVYFQEQGHGDRWNMVEKRVDLKRS-- 224
            |.:|:...:|.:|||.|.:|.:  |.::::  |....|.||.:.....|....:...|:...|  
  Fly   135 FNTNDVPVDLSLVQAMLRIYKQ--PSLVDR--RANFTVSVYRKLDNRQDFSYRILGSVNTTSSQR 195

Human   225 GWHTFPLTEAI------QALFERGERRLNL-DVQCDSCQELAVVPVFVDPGEESHRPFVV----- 277
            ||..|.||:.:      :.|..|.|.|::: |.|..:.....|.|   .....|..||:|     
  Fly   196 GWLEFNLTDTLRYWLHNKGLQRRNELRISIGDSQLSTFAAGLVTP---QASRTSLEPFIVGYFNG 257

Human   278 ------VQARLGDSRHRIR-KRGLE---CDGRT---------------NLCCRQQFFIDFRLIGW 317
                  :|        ::| ||.||   ..|.:               ..|.|..|.:||:.:..
  Fly   258 PELLVKIQ--------KLRFKRDLEKRRAGGGSPPPPPPPPVDLYRPPQSCERLNFTVDFKELHM 314

Human   318 NDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSM 382
            ::|:|||..:...:|.|.| .:..|...:|:: |..|  |..|....|.....||:||.|..:::
  Fly   315 HNWVIAPKKFEAYFCGGGC-NFPLGTKMNATN-HAIV--QTLMHLKQPHLPKPCCVPTVLGAITI 375

Human   383 LYFDDEYNIVKRDVPNMIVEECGC 406
            |.:.:|..|........:.:||||
  Fly   376 LRYLNEDIIDLTKYQKAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
INHBBNP_002184.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..62 93/414 (22%)
TGFb_propeptide 57..278 CDD:279078 55/265 (21%)
TGFB 303..406 CDD:214556 29/102 (28%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 52/249 (21%)
TGFB 300..400 CDD:214556 31/104 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.