DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and ATR1

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:512 Identity:104/512 - (20%)
Similarity:170/512 - (33%) Gaps:161/512 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 TDRTITSFEVTKD-------AGSWVGGIMPLAALAGGITGGPLIEYLGRRSTILATAVPFIVSSL 114
            |.:|::...:..|       :.||:....||.:.:..:..|.|.:..|.:..:|...|..|:.||
Yeast    86 TTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVIIWSL 150

  Fly   115 LIACAV-----NVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEVRGTLGLLPTALGNIGILVC 174
            :  |.:     :....:..|...|  :|||.                    :||..||.||.:  
Yeast   151 I--CGITKYSGSDTFFIISRAFQG--LGIAF--------------------VLPNVLGIIGNI-- 189

  Fly   175 YVAGSFMNWSMLAFLGAALPV----PFLILMIIIPETPR---W---------FVNRGQEERA--- 220
            ||.|:|....:::|:||..|:    ..|...:|..|.|:   |         |:|......|   
Yeast   190 YVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPS 254

  Fly   221 -------RKALKWLRGKEADVEPELKELMQSQADAD--RQATQNTCLEL--------------FK 262
                   ..::.|:......:...|...:.:||...  .||.....|.:              |.
Yeast   255 TIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIRFA 319

  Fly   263 RNNLKP---------LSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNL---STIIVGVVN 315
            :..|.|         :.|.|.|.|.....||....::..|:          |:   :.:..|...
Yeast   320 KTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQL----------NIRQYTALWAGGTY 374

  Fly   316 FFATFMGII-------LIDRLGRKILLYVSDIAMIVTLSILGG-------FFYCKAHGPDVSHLG 366
            |.....|||       .|..:...:.|:.|.:|..|. ||:..       :|.        :.||
Yeast   375 FMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVG-SIMASVTPVHETYFR--------TQLG 430

  Fly   367 WLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMG 431
            .:     :|...|..|.| |...::..:.||.:.:|.|.|:|.        .|......|.:.||
Yeast   431 TM-----IILSFGMDLSF-PASSIIFSDNLPMEYQGMAGSLVN--------TVVNYSMSLCLGMG 481

  Fly   432 A-----------------HGAFWL-FG----AICIVGLFFVIIFVPETRGKSLEEIE 466
            |                 .||.:| .|    |..|.||:.|..|:...|.::..|.:
Yeast   482 ATVETQVNSDGKHLLKGYRGAQYLGIGLASLACMISGLYMVESFIKGRRARAAAEYD 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 104/512 (20%)
MFS 33..454 CDD:119392 101/498 (20%)
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 97/489 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.