DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and VBA2

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_009852.3 Gene:VBA2 / 852596 SGDID:S000000497 Length:474 Species:Saccharomyces cerevisiae


Alignment Length:278 Identity:59/278 - (21%)
Similarity:111/278 - (39%) Gaps:77/278 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLAALSVSLCSLVVGFVS---AYTSPALVSMTDRTITSFEVTKDAGSWVGGIMPLAALAGGITGG 90
            ::..|::.|..|.:|..:   ::|||:::.:.                ||.::.|          
Yeast   174 IITGLTLQLLYLSLGCSTSKLSWTSPSVLLLL----------------VGSVIIL---------- 212

  Fly    91 PLIEYLGRRSTILATAVPF-IVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVY----LGE- 149
             |:..|..|.|.....:|. :|:|..      .:::|....|.||.......:||::    ||: 
Yeast   213 -LLFILHERKTSARAIIPMELVNSSY------SVVVLSISILVGFASYAYLFTLPLFFQIVLGDS 270

  Fly   150 TLQPEVRGTLGLLPTALGNIGILVCYVAGSFMN----WSMLAFLGAALPVPFLILMIIIPET-PR 209
            |.:..:|.|:..|.|.:|::      :.|..|:    ..:|.::|.:|......|.:.|.:| |.
Yeast   271 TAKAGLRLTIPSLFTPVGSL------ITGFSMSKYNCLRLLLYIGISLMFLGNFLFLFIEKTSPN 329

  Fly   210 WFV-------NRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKR-NNL 266
            |.:       |.||            |............|.|::|   |||..:.|.||:. .::
Yeast   330 WLIGLFLIPANLGQ------------GITFPTTLFTFIFMFSKSD---QATATSTLYLFRSIGSV 379

  Fly   267 KPLSISLGLMFFQQFSGI 284
            ..::||.|::.. .|:|:
Yeast   380 WGVAISAGVIQL-SFAGL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 59/276 (21%)
MFS 33..454 CDD:119392 59/274 (22%)
VBA2NP_009852.3 MFS 1..384 CDD:421695 54/263 (21%)
TRI12 <107..>249 CDD:115279 19/107 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.