DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and STP11

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_197718.1 Gene:STP11 / 832391 AraportID:AT5G23270 Length:514 Species:Arabidopsis thaliana


Alignment Length:420 Identity:123/420 - (29%)
Similarity:198/420 - (47%) Gaps:49/420 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLP 144
            ||||........:....||:.:::..::.|:..:||...|:|:.|::.||...|..||.|:.|:|
plant    93 LAALFASFLASTITRLFGRKVSMVIGSLAFLSGALLNGLAINLEMLIIGRLFLGVGVGFANQSVP 157

  Fly   145 VYLGETLQPEVRGTLGLLPTALGNIGIL----VCYVAGSFMN---WSMLAFLGAALPVPFLILMI 202
            :||.|....::||.|.:.......||||    |.||.....|   |.:...|.....|..|:...
plant   158 LYLSEMAPAKIRGALNIGFQLAITIGILAANIVNYVTPKLQNGIGWRLSLGLAGVPAVMMLVGCF 222

  Fly   203 IIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNLK 267
            .:|:||...:.||.:|:|::.|:.:|| ..:||.|..||..:...|.:  .::....:.:.....
plant   223 FLPDTPNSILERGNKEKAKEMLQKIRG-TMEVEHEFNELCNACEAAKK--VKHPWTNIMQARYRP 284

  Fly   268 PLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNL-STIIVGVVNFFATFMGIILIDRLGR 331
            .|:....:.||||.:|||.::||...:||..|...|::| |.:|.|:||..:|.:.|..:|:.||
plant   285 QLTFCTFIPFFQQLTGINVIMFYAPVLFKTIGFGNDASLISAVITGLVNVLSTIVSIYSVDKFGR 349

  Fly   332 KILLYVSDIAMIVTLSILGGFFYCKAHGPDVSHLGW------------------LPLTCFVIYIL 378
            :.|.......||||...:|            |.:||                  |.|.|  :|:.
plant   350 RALFLQGGFQMIVTQIAVG------------SMIGWKFGFNGEGNLSGVDADIILALIC--LYVA 400

  Fly   379 GFSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAIC 443
            ||:..:||:.||:..||.|.:||....|:..:.|.|.||.:.:.|..:...| ..|.|:.|..:.
plant   401 GFAWSWGPLGWLVPSEICPLEIRSAGQSLNVSVNMFFTFFIGQFFLTMLCHM-KFGLFYFFAGMV 464

  Fly   444 IVGLFFVIIFVPETRGKSLEEIERKMMGRV 473
            ::...|:...:|||:|..:||     ||:|
plant   465 LIMTIFIYFLLPETKGVPIEE-----MGKV 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 120/412 (29%)
MFS 33..454 CDD:119392 114/399 (29%)
STP11NP_197718.1 Sugar_tr 28..490 CDD:278511 123/420 (29%)
MFS 79..474 CDD:119392 114/398 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.