DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and AT3G19940

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_188628.1 Gene:AT3G19940 / 821532 AraportID:AT3G19940 Length:514 Species:Arabidopsis thaliana


Alignment Length:407 Identity:127/407 - (31%)
Similarity:202/407 - (49%) Gaps:24/407 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LAALAGGITGGPLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLP 144
            ||||........:....||:.::....:.|::.:|..|.||||.|::.||.|.|..||.|:.|.|
plant    93 LAALVASFMASVITRKHGRKVSMFIGGLAFLIGALFNAFAVNVSMLIIGRLLLGVGVGFANQSTP 157

  Fly   145 VYLGETLQPEVRGTLGLLPTALGNIGILVC----YVAGSFMNWSMLAFLGAALPVPFLILMI--- 202
            |||.|....::||.|.:.......|||||.    |.............||.| .||.::::|   
plant   158 VYLSEMAPAKIRGALNIGFQMAITIGILVANLINYGTSKMAQHGWRVSLGLA-AVPAVVMVIGSF 221

  Fly   203 IIPETPRWFVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTCLELFKRNNLK 267
            |:|:||...:.||:.|.|::.||.:||.: :|:.|.::|:.:...|.:  .:|....:.:.....
plant   222 ILPDTPNSMLERGKNEEAKQMLKKIRGAD-NVDHEFQDLIDAVEAAKK--VENPWKNIMESKYRP 283

  Fly   268 PLSISLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNL-STIIVGVVNFFATFMGIILIDRLGR 331
            .|.....:.||||.:|||.::||...:||..|...|:.| |.:|.||||..:||:.|..:||.||
plant   284 ALIFCSAIPFFQQITGINVIMFYAPVLFKTLGFGDDAALMSAVITGVVNMLSTFVSIYAVDRYGR 348

  Fly   332 KILLYVSDIAMIVTLSILGGFFYCKAHGPDVSHL-----GWLPLTCFVIYILGFSLGFGPIPWLM 391
            ::|.....|.|.:...::|.|...:........|     .|: |....:|:.||:..:||:.||:
plant   349 RLLFLEGGIQMFICQLLVGSFIGARFGTSGTGTLTPATADWI-LAFICVYVAGFAWSWGPLGWLV 412

  Fly   392 MGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPE 456
            ..||.|.:||....::..:.|.|.||::.:.|..:...| ..|.|:.|.::..:...|:...:||
plant   413 PSEICPLEIRPAGQAINVSVNMFFTFLIGQFFLTMLCHM-KFGLFYFFASMVAIMTVFIYFLLPE 476

  Fly   457 TRGKSLEEIERKMMGRV 473
            |:|..:||     ||||
plant   477 TKGVPIEE-----MGRV 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 123/399 (31%)
MFS 33..454 CDD:119392 117/386 (30%)
AT3G19940NP_188628.1 Sugar_tr 29..489 CDD:278511 127/407 (31%)
MFS 79..475 CDD:119392 117/387 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.