DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and CG33281

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_995620.1 Gene:CG33281 / 2768938 FlyBaseID:FBgn0053281 Length:467 Species:Drosophila melanogaster


Alignment Length:454 Identity:126/454 - (27%)
Similarity:230/454 - (50%) Gaps:16/454 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QVLAALSVSLCSLVVGFVSAYTSPALVSMTDRT--ITSFEVTKDAGSWVGGIMPLAALAGGITGG 90
            |.|||:||::.|:..|....:.|.:.:.::...  :.:..:|.....||...:.|..|.|.....
  Fly    10 QYLAAISVNIISISYGAFCGWPSSSFLELSSENSPLDTGPLTPTDQGWVASNICLGGLVGTFLFT 74

  Fly    91 PLIEYLGRRSTILATAVPFIVSSLLIACAVNVIMILCGRFLTGFCVGIASLSLPVYLGETLQPEV 155
            .|.:.:||:..::..|:|.::..::|..|...:.::..||:.|...|.....:|:|:.|.....:
  Fly    75 WLADRIGRKLCLMWMALPNLLGWVIIPFARTPMHLIIARFIGGAAGGGCFTVIPIYIAELASDNI 139

  Fly   156 RGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLGAALPVPFLILMIIIPETPRWFVNRGQEERA 220
            ||.||:......|.|:::.:|.|.:.|::.::::.::|...|:.....:||||:......:.|.|
  Fly   140 RGILGVFLVLTCNFGLVLAFVLGYYFNYAQVSWIVSSLSFVFVGCFWFMPETPQHLAKINKIEEA 204

  Fly   221 RKALKWLRGKEADVEPELKELMQSQ--------------ADADRQATQNTCLELFKRNNLKPLSI 271
            ..:|::.|..:::...||.|.:|.:              .|.|..||..|..:..:....|...|
  Fly   205 EHSLRYYRNIKSNPAKELSEELQLELQKLKTTEKTTADGVDDDDAATGVTWSDFAEGKTRKAFLI 269

  Fly   272 SLGLMFFQQFSGINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDRLGRKILLY 336
            .|||:.|.|..|..|::.||..||:.|||::...::.|||||:....|:...:|::||||||||.
  Fly   270 GLGLISFNQLCGCFAMLNYTAVIFEQAGSSLPPTVAAIIVGVIQLMGTYASTVLVERLGRKILLL 334

  Fly   337 VSDIAMIVTLSILGGFFYCKAHGPDVSHLGWLPLTCFVIYILGFSLGFGPIPWLMMGEILPAKIR 401
            ||.:.:.:..|.:|.:.|.:..|..|:...|:|:..|...:...::|...:|:|::.||:|.|||
  Fly   335 VSAVGIGLGQSAMGTYSYFQMLGCPVASFSWVPIAGFSFMLFLAAVGLLSLPFLVVSEIMPQKIR 399

  Fly   402 GPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEI 465
            ..|..::.:..|..:....|.....|.::|.||..::|.::..:...|:.||||||:|||::.|
  Fly   400 STAIMILMSTLWLISTCAVKLMPVFTESLGMHGTVFMFASLSFLAAIFIAIFVPETKGKSVDAI 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 124/451 (27%)
MFS 33..454 CDD:119392 113/436 (26%)
CG33281NP_995620.1 MFS 50..452 CDD:119392 108/401 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444439
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48021
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
65.850

Return to query results.
Submit another query.