DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and srx-118

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_496675.2 Gene:srx-118 / 188681 WormBaseID:WBGene00006009 Length:328 Species:Caenorhabditis elegans


Alignment Length:190 Identity:41/190 - (21%)
Similarity:70/190 - (36%) Gaps:46/190 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 LSISLGLMFFQQFS-----GINAVIFYTVQIFKDAGSTIDSNLSTIIVGVVNFFATFMGIILIDR 328
            :|..|....:.:||     .::||:...|.|.   ||         |:.|:.|.|||..:...|.
 Worm     1 MSSVLDEFLYSEFSTPSTRTVSAVMLIVVSII---GS---------IMNVLIFIATFFRVTKRDG 53

  Fly   329 LGRKILLYVSDIAMIVTLSILG------------GFFYCKAHGPDVSHLGWL--PLTCFVIYILG 379
            . .||..:.|..:.||.:..|.            ..:...|.|..::..||.  ||:..::.:..
 Worm    54 F-LKICCFNSFGSCIVCIGYLAFPVPSLLLEDPPNHWLNAAMGQFIAWFGWSIGPLSQILLTVNR 117

  Fly   380 FSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDLTVAMGAHGAFWLF 439
            ....:.|:.::       .|.|....:|...|::|..|:       |.|:....|..:||
 Worm   118 IIAVYFPLLYM-------KKYRYNPTNVGIGFSFFVAFI-------LLVSFFPEGCHYLF 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 41/190 (22%)
MFS 33..454 CDD:119392 41/190 (22%)
srx-118NP_496675.2 7TM_GPCR_Srx 27..285 CDD:370981 35/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.