DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and K09C4.2

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:108 Identity:22/108 - (20%)
Similarity:37/108 - (34%) Gaps:43/108 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 GFGPIPWLMMGEILPAKIRG---------------PAASVVTAFN------WFCTFVVTKTFQDL 426
            |...|..|.:.|:.|...|.               |..|:....|      :|..||:.:|    
 Worm    13 GANAIRLLFVTELFPPSARTVVGQAMLFGSMAVGMPVVSLFPIINSIFSPIFFVPFVIVQT---- 73

  Fly   427 TVAMGAHGAFWLFGAICIVGLFFVIIFVPETRGKSLEEIERKM 469
                       :||       .::..::|||||:::.:|...|
 Worm    74 -----------VFG-------IYLYRYMPETRGRAVYDIIESM 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 21/104 (20%)
MFS 33..454 CDD:119392 15/91 (16%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.