DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tret1-2 and SLC2A7

DIOPT Version :9

Sequence 1:NP_610694.1 Gene:Tret1-2 / 36249 FlyBaseID:FBgn0033644 Length:488 Species:Drosophila melanogaster
Sequence 2:XP_011539126.1 Gene:SLC2A7 / 155184 HGNCID:13445 Length:517 Species:Homo sapiens


Alignment Length:437 Identity:131/437 - (29%)
Similarity:211/437 - (48%) Gaps:60/437 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLAALSVSLCS-LVVGF-VSAYTSPALVSMTDRTITSFEVTKDAGSWVGGIM-----------PL 80
            :||.||.:..| ...|: :|...:|..|..:....|.||  :.|....|.:|           ||
Human    24 LLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETYFE--RHATFMDGKLMLLLWSCTVSMFPL 86

  Fly    81 AALAGGITGGPLIEYLGRRSTILATAVPFIVSSLL-----IACAVNVIMILCGRFLTGFCVGIAS 140
            ..|.|.:..|.|::..||:.|:|...:..|:.::|     :|.|..:|:.  .|.:.|.|.||:.
Human    87 GGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAILMGVSKVAKAFELIVF--SRVVLGVCAGISY 149

  Fly   141 LSLPVYLGETLQPEVRGTLGLLPTALGNIGILVCYVAGSFMNWSMLAFLG---------AALPVP 196
            .:||:||||.....:||.:|.:......:|:.:..:      :|:.|.||         |...||
Human   150 SALPMYLGELAPKNLRGMVGTMTEVFVIVGVFLAQI------FSLQAILGNPAGWPVLLALTGVP 208

  Fly   197 FLILMIII---PETPRW-FVNRGQEERARKALKWLRGKEADVEPELKELMQSQADADRQATQNTC 257
            .|:.::.:   ||:||: .:.:|.|..||:||:.||| ..|:|.||:: |:::|.|:|.....:.
Human   209 ALLQLLTLPFFPESPRYSLIQKGDEATARQALRRLRG-HTDMEAELED-MRAEARAERAEGHLSV 271

  Fly   258 LELFKRNNLK--PLSISLGLMFFQQFSGINAVIFYTVQIFKDAG-STIDSNLSTIIVGVVNFFAT 319
            |.|....:|:  .||| :.||..||.|||||:.:|...|:..|| ....|...|:..||||...|
Human   272 LHLCALRSLRWQLLSI-IVLMAGQQLSGINAINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMT 335

  Fly   320 FMGIILIDRLGRKILLYV-----SDIAMIVTLSILGGFFYCKAHGPDVSHLGWLPLTCFVIYILG 379
            ....:|::||||:.||..     ....:::|:.:|   |..:.  |::|:||   :.|...||.|
Human   336 ITSAVLVERLGRRHLLLAGYGICGSACLVLTVVLL---FQNRV--PELSYLG---IICVFAYIAG 392

  Fly   380 FSLGFGPIPWLMMGEILPAKIRGPAASVVTAFNWFCTFVVTKTFQDL 426
            .|:|..|:|.::..||.....|..|..|..|.:|...|::...|..:
Human   393 HSIGPSPVPSVVRTEIFLQSSRRAAFMVDGAVHWLTNFIIGFLFPSI 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tret1-2NP_610694.1 Sugar_tr 31..467 CDD:278511 130/435 (30%)
MFS 33..454 CDD:119392 129/433 (30%)
SLC2A7XP_011539126.1 Sugar_tr 26..441 CDD:278511 130/435 (30%)
MFS 100..439 CDD:119392 110/357 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144003
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.